Online Inquiry
DTD2 Antibody
SPA-03041
| Size | Price |
| 0.1 mL | Online Inquiry |
| 25 µL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | DTD2 |
| Gene Abbr. | DTD2 |
| Gene ID | 112487 |
| Full Name | D-aminoacyl-tRNA deacylase 2 |
| Alias | ATD, C14orf126 |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Synthetic peptide directed towards the middle region of human C14orf126The immunogen for this antibody is C14orf126. Peptide sequence ETENGKHVSILDLPGNILIIPQATLGGRLKGRNMQYHSNSGKEEGFELYS. The peptide sequence for this immunogen was taken from within the described region. |
| Usage | |
|---|---|
| Application | WB |
| Dilutions | Western Blot (1:1000) |
| Reactivity | Human, Mouse, Rat, Canine, Guinea Pig, Rabbit |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS and 2% Sucrose. |
| Preservative | 0.09% Sodium Azide |
| Storage Temp. | Store at -20 °C. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.