Online Inquiry
Derlin-3 Antibody
SPA-02904
Size | Price |
0.1 mL | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | Derlin-3 |
Gene Abbr. | DERL3 |
Gene ID | 91319 |
Full Name | derlin 3 |
Alias | C22orf14, IZP6, LLN2, derlin-3 |
Introduction | DERL3 belongs to the derlin family, and resides in the endoplasmic reticulum (ER). Proteins that are unfolded or misfolded in the ER must be refolded or degraded to maintain the homeostasis of the ER. This protein appears to be involved in the degradation of misfolded glycoproteins in the ER. Several alternatively spliced transcript variants encoding different isoforms have been identified for this gene.Proteins that are unfolded or misfolded in the endoplasmic reticulum (ER) must be refolded or degraded to maintain the homeostasis of the ER. DERL3 is involved in the degradation of misfolded glycoproteins in the ER (Oda et al., 2006 [PubMed 16449189]).[supplied by OMIM]. |
Product Details | |
---|---|
Host | Rabbit |
Clonality | Polyclonal |
Clone No. | N/A |
Isotype | IgG |
Immunogen | Synthetic peptides corresponding to Derlin-3 (Der1-like domain family, member 3) The peptide sequence was selected from the C terminal of Derlin-3 (NP_001002862). Peptide sequence YYFLEDVFPNQPGGKRLLQTPGFLKLLLDAPAEDPNYLPLPEEQPGPHLP. The peptide sequence for this immunogen was taken from within the described region. |
Usage | |
---|---|
Application | WB |
Dilutions | Western Blot (0.2-1 µg/mL) |
Reactivity | Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish |
Storage & Handling | |
---|---|
Storage Buffer | PBS and 2% Sucrose. |
Preservative | 0.09% Sodium Azide |
Storage Temp. | Store at -20 °C. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.