Online Inquiry
DEPTOR/DEPDC6 Antibody
SPA-02899
| Size | Price |
| 25 µg | Online Inquiry |
| 100 µg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | DEPTOR/DEPDC6 |
| Gene Abbr. | DEPTOR |
| Gene ID | 64798 |
| Full Name | DEP domain containing MTOR interacting protein |
| Alias | DEP.6, DEPDC6 |
| Introduction | DEPTOR/DEPDC6 is a component of both mTORC1 and mTORC2 complexes. It interacts with mTOR and inhibits mTORC1 and mTORC2 kinase activities. mTOR, along with casein kinase I, phosphorylates DEPTOR/DEPDC6 in the presence of growth signals, which leads to the degradation of DEPTOR/DEPDC6. Research studies have shown that transgenic mice overexpressing DEPTOR/DEPDC6 have more white adipose tissue, and DEPTOR/DEPDC6 expression levels increase in the white adipose tissue of obese humans. Furthermore, the expression of DEPTOR/DEPDC6 is induced during mouse adipocyte differentiation. Together these findings suggest that DEPTOR/DEPDC6 regulates adipogenesis. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to amino acids: LVTGEQLRLRLHEEKVIKDRRHHLKTYPNCFVAKELIDWLIEHKEASDRETAIKLMQKLADRGIIHHVCDEH. |
| Usage | |
|---|---|
| Application | WB, IHC |
| Dilutions | Western Blot (0.04-0.4 µg/mL); Immunohistochemistry (1:20-1:50) |
| MW(KDa) | 48 |
| Reactivity | Human, Mouse, Rat |
| Specificity | Specificity of human, mouse, rat DEPTOR/DEPDC6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.