Cytosolic Sulfotransferase 2A1/SULT2A1 Antibody - CD BioSciences

service-banner

Cytosolic Sulfotransferase 2A1/SULT2A1 Antibody

Cytosolic Sulfotransferase 2A1/SULT2A1 Antibody

SPA-10449

Size Price
100 µL Online Inquiry
More Options Online Inquiry
Target Information
Target Name SULT2A1
Gene Abbr. SULT2A1
Gene ID 6822
Full Name sulfotransferase family 2A member 1
Alias DHEA-ST, DHEAS, HST, ST2, ST2A1
Introduction This gene encodes a member of the sulfotransferase family. Sulfotransferases aid in the metabolism of drugs and endogenous compounds by converting these substances into more hydrophilic water-soluble sulfate conjugates that can be easily excreted. This protein catalyzes the sulfation of steroids and bile acids in the liver and adrenal glands, and may have a role in the inherited adrenal androgen excess in women with polycystic ovary syndrome. [provided by RefSeq].
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Recombinant Protein corresponding to amino acids: EFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIW.
Usage
Application WB, IHC
Dilutions Western Blot (0.04-0.4 µg/mL); Immunohistochemistry (1:200-1:500)
Reactivity Human
Specificity Specificity of human Cytosolic Sulfotransferase 2A1/SULT2A1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.