Online Inquiry
Cytokeratin 14 Antibody
SPA-02764
Size | Price |
100 µL | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | Cytokeratin 14 |
Gene Abbr. | KRT14 |
Gene ID | 3861 |
Full Name | keratin 14 |
Alias | CK14, EBS3, EBS4, K14, NFJ |
Introduction | Keratin 14 is a member of the keratin family, the most diverse group of intermediate filaments. It is usually found as a heterotetramer with two molecules of keratin 5, a type II keratin. Together they form the cytoskeleton of epithelial cells. Mutations in the genes for these keratins are associated with epidermolysis bullosa simplex. Keratin 14 has been studied as a prognostic marker in breast cancer. This antibody labels the basal layer of stratifying squamous and non-squamous epithelia. The staining pattern iscytoplasmic. It recognizes basal cell carcinomas and squamous cell carcinomas. |
Product Details | |
---|---|
Host | Rabbit |
Clonality | Polyclonal |
Clone No. | N/A |
Isotype | IgG |
Immunogen | Recombinant Protein corresponding to amino acids: TYRRLLEGEDAHLSSSQFSSGSQSSRDVTSSSRQIRTKVMDVHDGKVVSTHEQVLRTKN. |
Usage | |
---|---|
Application | WB, IHC |
Dilutions | Western Blot (0.04-0.4 µg/mL); Immunohistochemistry (1:1000-1:2500) |
Reactivity | Human |
Specificity | Specificity of human Cytokeratin 14 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Storage & Handling | |
---|---|
Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
Preservative | 0.02% Sodium Azide |
Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.