Cytokeratin 14 Antibody - CD BioSciences

service-banner

Cytokeratin 14 Antibody

Cytokeratin 14 Antibody

SPA-02764

Size Price
100 µL Online Inquiry
More Options Online Inquiry
Target Information
Target Name Cytokeratin 14
Gene Abbr. KRT14
Gene ID 3861
Full Name keratin 14
Alias CK14, EBS3, EBS4, K14, NFJ
Introduction Keratin 14 is a member of the keratin family, the most diverse group of intermediate filaments. It is usually found as a heterotetramer with two molecules of keratin 5, a type II keratin. Together they form the cytoskeleton of epithelial cells. Mutations in the genes for these keratins are associated with epidermolysis bullosa simplex. Keratin 14 has been studied as a prognostic marker in breast cancer. This antibody labels the basal layer of stratifying squamous and non-squamous epithelia. The staining pattern iscytoplasmic. It recognizes basal cell carcinomas and squamous cell carcinomas.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Recombinant Protein corresponding to amino acids: TYRRLLEGEDAHLSSSQFSSGSQSSRDVTSSSRQIRTKVMDVHDGKVVSTHEQVLRTKN.
Usage
Application WB, IHC
Dilutions Western Blot (0.04-0.4 µg/mL); Immunohistochemistry (1:1000-1:2500)
Reactivity Human
Specificity Specificity of human Cytokeratin 14 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.