Online Inquiry
Cysteinyl Leukotriene R2/CysLTR2 Antibody
SPA-02660
| Size | Price |
| 0.05 mL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | Cysteinyl Leukotriene Receptor |
| Gene Abbr. | CYSLTR2 |
| Gene ID | 57105 |
| Full Name | cysteinyl leukotriene receptor 2 |
| Alias | CYSLT2, CYSLT2R, GPCR21, HG57, HPN321 |
| Introduction | Cysteinyl leukotriene receptor 2 (CysLT2) is a Chemoattractant Receptor that binds neutrophil chemoattractants such as cysteinyl leukotrienes. These ligands have potent proinflammatory activity and are implicated in many features of asthma including edema, bronchial constriction, and hyperreactivity (Bisgaard et al., 2000). Activation of cysteinyl leukotriene receptor 2 induces cell contraction and/or relaxation. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to amino acids: KFMSLQPSISVSEMEPNGTFSNNNSRNCTIE. |
| Usage | |
|---|---|
| Application | IHC |
| Dilutions | Immunohistochemistry (1:500-1:1000) |
| Reactivity | Human |
| Specificity | Specificity of human Cysteinyl Leukotriene R2/CysLTR2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.