CYP27A1 Antibody - CD BioSciences

service-banner

CYP27A1 Antibody

CYP27A1 Antibody

SPA-02702

Size Price
100 µL Online Inquiry
More Options Online Inquiry
Target Information
Target Name Cytochrome P450
Gene Abbr. CYP27A1
Gene ID 1593
Full Name cytochrome P450 family 27 subfamily A member 1
Alias CP27, CTX, CYP27
Introduction This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This mitochondrial protein oxidizes cholesterol intermediates as part of the bile synthesis pathway. Since the conversion of cholesterol to bile acids is the major route for removing cholesterol from the body, this protein is important for overall cholesterol homeostasis. Mutations in this gene cause cerebrotendinous xanthomatosis, a rare autosomal recessive lipid storage disease. [provided by RefSeq]
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Recombinant Protein corresponding to amino acids: RQRSLEEIPRLGQLRFFFQLFVQGYALQLHQLQVLYKAKYGPMWMSYLGPQMHVNLASAPLLEQVMRQEGKYPVRNDMELWKEHRDQHDLTYGPFTTEGHHWYQLRQALNQRLLKPAEAALYTDAFNEVIDDFMTRLD.
Usage
Application WB, IF, IHC
Dilutions Western Blot (0.04-0.4 µg/mL); Immunofluorescence (0.25-2 µg/mL); Immunohistochemistry (1:200-1:500)
Reactivity Human
Specificity Specificity of human CYP27A1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.