Online Inquiry
CXCL11/I-TAC Antibody
SPA-02474
| Size | Price |
| 25 µg | Online Inquiry |
| 100 µg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | CXCL11 |
| Gene Abbr. | CXCL11 |
| Gene ID | 6373 |
| Full Name | C-X-C motif chemokine ligand 11 |
| Alias | H174, I-TAC, IP-9, IP9, SCYB11 |
| Introduction | CXCL11, also known as I-TAC, SCYB9B, H174 and beta -R1, is a non-ELR CXC chemokine. CXCL11 cDNA encodes a 94 amino acid (aa) residue precursor protein with a 21 aa residue putative signal sequence, which is cleaved to form the mature 73 aa residue protein. CXCL11 shares 36% and 37% amino acid sequence homology with IP-10 and MIG (two other known human non-ELR CXC chemokines), respectively. CXCL11 is expressed at low levels in normal tissues including thymus, spleen, and pancreas. The expression of CXCL11 mRNA is radically up regulated in IFN-gamma and IL-1 stimulated astrocytes. Moderate increase in expression is also observed in stimulated monocytes. CXCL11 has potent chemoattractant activity for IL-2 activated T cells and transfected cell lines expressing CXCR3 but not freshly isolated T cells, neutrophils, or monocytes. The gene encoding CXCL11 has been mapped to chromosome 4. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | CXCL11 (NP_005400.1, 1 a.a. - 94 a.a.) full-length human protein. MSVKGMAIALAVILCATVVQGFPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF. |
| Usage | |
|---|---|
| Application | WB, IHC |
| Reactivity | Human, Mouse |
| Specificity | CXCL11 - chemokine (C-X-C motif) ligand 11. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.4). |
| Preservative | No Preservative |
| Storage Temp. | Aliquot and store at -20 °C or -80 °C. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.