CX3CR1 Antibody - CD BioSciences

service-banner

CX3CR1 Antibody

CX3CR1 Antibody

SPA-02454

Size Price
0.1 mg Online Inquiry
More Options Online Inquiry
Target Information
Target Name CX3CR1
Gene Abbr. CX3CR1
Gene ID 1524
Full Name C-X3-C motif chemokine receptor 1
Alias CCRL1, CMKBRL1, CMKDR1, GPR13, GPRV28
Introduction CX3CR1 is one of the chemokine receptors that are required as coreceptors for HIV infection. The genes encoding human, murine, and rat CX3CR1 were cloned and designated V28 and CMKBRL1, CX3CR1, and RBS11, respectively. The encoded seven transmembrane protein was recently identified as the receptor for a novel transmembrane molecule, fractalkine, and renamed CX3CR1. Recently, CX3CR1 was found to serve as a coreceptor for HIV-1 and HIV-2 envelope fusion and virus infection, which can be inhibited by fractokine. CX3CR1 mediates leukocyte migration and adhesion. CX3CR1 is expressed in a variety of human tissues and cell lines.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Recombinant Protein corresponding to amino acids: HLYGKCLAVLCGRSVHVDFSSSESQRSRHGSVLSSNFTYHTSDGDA.
Usage
Application IF
Dilutions Immunofluorescence (0.25-2 µg/mL)
Reactivity Human
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.