Online Inquiry
Common gamma Chain/IL-2 R gamma Antibody
SPA-05756
| Size | Price | 
| 25 µg | Online Inquiry | 
| 100 µg | Online Inquiry | 
| More Options | Online Inquiry | 
| Target Information | |
|---|---|
| Target Name | IL-2 Receptor | 
| Gene Abbr. | IL2RG | 
| Gene ID | 3561 | 
| Full Name | interleukin 2 receptor subunit gamma | 
| Alias | CD132, CIDX, IL-2RG, IMD4, P64 | 
| Introduction | The Common gamma Chain, also known as CD132, is a transmembrane protein belonging to the hematopoietin receptor family. gamma c is a signaling component of the functional receptor complexes for IL-2, IL-4, IL-7, IL-9, and IL-15. | 
| Product Details | |
|---|---|
| Host | Rabbit | 
| Clonality | Polyclonal | 
| Clone No. | N/A | 
| Isotype | IgG | 
| Immunogen | Recombinant Protein corresponding to the following amino acid sequence: TFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKENPFLFAL. | 
| Usage | |
|---|---|
| Application | IF | 
| Dilutions | Immunofluorescence (0.25-2 µg/mL) | 
| Reactivity | Human | 
| Specificity | Specificity of human Common gamma Chain/IL-2 R gamma antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | 
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. | 
| Preservative | 0.02% Sodium Azide | 
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. | 
| Handling | Avoid freeze-thaw cycles. | 
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.
