CDK5RAP1 Antibody - CD BioSciences

service-banner

CDK5RAP1 Antibody

CDK5RAP1 Antibody

SPA-02133

Size Price
0.02 mL Online Inquiry
0.1 mL Online Inquiry
More Options Online Inquiry
Target Information
Target Name CDK5RAP1
Gene Abbr. CDK5RAP1
Gene ID 51654
Full Name CDK5 regulatory subunit associated protein 1
Alias C20orf34, C42, CGI-05, HSPC167
Introduction Neuronal CDC2-like kinase, which is involved in the regulation of neuronal differentiation, is composed of a catalytic subunit, CDK5, and an activating subunit, p25NCK5A. The protein encoded by this gene binds to p25NCK5A and therefore may be involved in neuronal differentiation. Multiple transcript variants exist for this gene, but the full-length natures of only two have been determined. [provided by RefSeq]
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Synthetic peptide directed towards the C terminal of human Cdk5rap1The immunogen for this antibody is Cdk5rap1. Peptide sequence VIFPDAEVEDITDPGLKVRAQPGDYVLVKIISASSQTLKGHILCRTTMKD. The peptide sequence for this immunogen was taken from within the described region.
Usage
Application WB
Dilutions Western Blot (1:1000)
Reactivity Rat, Human, Mouse, Bovine, Equine, Guinea Pig, Rabbit
Storage & Handling
Storage Buffer PBS and 2% Sucrose.
Preservative 0.09% Sodium Azide
Storage Temp. Store at -20 °C.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.