CD40 Ligand/TNFSF5 Antibody - CD BioSciences

service-banner

CD40 Ligand/TNFSF5 Antibody

CD40 Ligand/TNFSF5 Antibody

SPA-02046

Size Price
25 µg Online Inquiry
100 µg Online Inquiry
More Options Online Inquiry
Target Information
Target Name CD40 Ligand
Gene Abbr. CD40LG
Gene ID 959
Full Name CD40 ligand
Alias CD154, CD40L, HIGM1, IGM, IMD3
Introduction CD40 ligand, CD40L (also known as CD154, TRAP or gp39), is a 261 amino acid type II transmembrane glycoprotein belonging to the TNF family, CD40L is expressed predominantly on activated CD4+ T lymphocytes, and also found in other types of cells, like NK cells, mast cells, basophils and eosinophils. Human CD40L shares 78% amino acid identity with its murine counterpart. The receptor of CD40L is CD40, a type I transmembrane glycoprotein belonging to the TNF receptor family. CD40 is expressed on B lymphocytes, monocytes, dendritic cells and thymic epithelium. Although all monomeric, dimeric and trimeric forms of soluble CD40L can bind to CD40, the trimeric form of soluble CD40L has the most potent biological activity through oligomerization of cell surface CD40, a common feature of TNF receptor family members. CD40L mediates a range of activities on B cells including induction of activation-associated surface antigen, entry into cell cycle, isotype switching and Ig secretion and memory generation. CD40-CD40L interaction also plays important roles in monocyte activation and dendritic cell maturation.

Armitage, R.J. et al. (1992) Nature 357:80.
Hollenbaugh, D. et al. (1992) EMBO J. 11:4313.
Spriggs, M.K. et al. (1992) J. Exp. Med. 176:1543.
Fanslow, W.C. et al. (1994) Seminars in Immunology 6:267.
Kooten, C.V. and J. Banchereau (2000) J. Leukoc. Biol. 67:2.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Synthetic peptides corresponding to CD40LG(CD40 ligand (TNF superfamily, member 5, hyper-IgM syndrome)) The peptide sequence was selected from the middle region of CD40LG. Peptide sequence ENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLEN The peptide sequence for this immunogen was taken from within the described region.
Usage
Application WB, IHC
Dilutions Western Blot (0.2-1 µg/mL); Immunohistochemistry (1:10-1:500)
Reactivity Human, Porcine, Bovine, Canine, Equine, Rabbit, Sheep
Storage & Handling
Storage Buffer PBS and 2% Sucrose.
Preservative 0.09% Sodium Azide
Storage Temp. Store at -20 °C.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.