CD3γ Antibody - CD BioSciences

service-banner

CD3γ Antibody

CD3γ Antibody

SPA-01956

Size Price
0.1 mL Online Inquiry
25 µL Online Inquiry
More Options Online Inquiry
Target Information
Target Name CD3
Gene Abbr. CD3G
Gene ID 917
Full Name CD3g molecule
Alias CD3-GAMMA, IMD17, T3G
Introduction When T cells encounter antigens via the T cell receptor (TCR), information about the quantity and quality of antigens is relayed to the intracellular signal transduction machinery. This activation process depends mainly on CD3 (Cluster of Differentiation 3), a multiunit protein complex that directly associates with the TCR. CD3 is composed of four polypeptides: ζ, γ, ε and δ. Each of these polypeptides contains at least one immunoreceptor tyrosine-based activation motif (ITAM). Engagement of TCR complex with foreign antigens induces tyrosine phosphorylation in the ITAM motifs and phosphorylated ITAMs function as docking sites for signaling molecules such as ZAP-70 and p85 subunit of PI-3 kinase. TCR ligation also induces a conformational change in CD3ε, such that a proline region is exposed and then associates with the adaptor protein Nck.The CD3ζ invariant chain is a type-I transmembrane protein that exists in the TCR signaling complex as a disulfide-linked homodimer.
Product Details
Host Mouse
Clonality Monoclonal
Clone No. 2A6
Isotype IgG2A Kappa
Immunogen CD3G (NP_000064, 23 a.a. ~ 111 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELN.
Usage
Application ELISA
Reactivity Human
Specificity CD3G - CD3G antigen, gamma polypeptide (TiT3 complex).
Storage & Handling
Storage Buffer In 1X PBS, pH 7.4.
Preservative No Preservative
Storage Temp. Aliquot and store at -20 °C or -80 °C.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.