Online Inquiry
CCR7 Antibody
SPA-01781
| Size | Price |
| 0.02 mg | Online Inquiry |
| 0.1 mg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | CCR7 |
| Gene Abbr. | CCR7 |
| Gene ID | 1236 |
| Full Name | C-C motif chemokine receptor 7 |
| Alias | BLR2, CC-CKR-7, CCR-7, CD197, CDw197 |
| Introduction | CCR7 (Chemokine Receptor 7; also CD197) is a 7 transmembrane (7TM) G protein-coupled chemokine receptor for the homeostatic chemokines CCL19/MIP-3 beta and CCL21/6Ckine. CCL19 and CCL21 are constitutively expressed by high endothelial venule epithelial cells or fibroblastic reticular cells in secondary lymphoid organs. CCR7 is upregulated on dendritic cells, naïve and memory T cells, Treg, NK cells, and B cells following inflammatory stimulation. Its expression enables the function of immune cell trafficking to and retention in regional lymph nodes for expansion of the adaptive immune response. Human CCR7 shares 87% amino acid sequence identity with mouse CCR7. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to the following amino acid sequence: GVKFRNDLFKLFKDLGCLSQEQLRQWSSCRHIRRSSMSVEAETTTTFS. |
| Usage | |
|---|---|
| Application | IF |
| Dilutions | Immunofluorescence (0.25-2 µg/mL) |
| Reactivity | Human |
| Specificity | Specificity of human CCR7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.