Online Inquiry
CCR11 Antibody
SPA-01730
| Size | Price |
| 0.05 mL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | CCR11 |
| Gene Abbr. | ACKR4 |
| Gene ID | 51554 |
| Full Name | atypical chemokine receptor 4 |
| Alias | CC-CKR-11, CCBP2, CCR-11, CCR10, CCR11 |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | The specific Immunogen is proprietary information. Peptide sequence SIALFHSCLNPILYVFMGASFKNYVMKVAKKYGSWRRQRQSVEEFPFDSE. The peptide sequence for this immunogen was taken from within the described region. |
| Usage | |
|---|---|
| Application | WB, IF, IHC |
| Dilutions | Western Blot (1:1000); Immunofluorescence (1:10-1:500); Immunohistochemistry (1:10-1:500) |
| Reactivity | Human, Mouse, Bovine, Equine, Guinea Pig |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS and 2% Sucrose. |
| Preservative | 0.09% Sodium Azide |
| Storage Temp. | Store at -20 °C. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.