Online Inquiry
CAR/NR1I3 Antibody
SPA-08216
Size | Price |
100 µg | Online Inquiry |
More Options | Online Inquiry |
Target Information | |
---|---|
Target Name | NR1I3/CAR |
Gene Abbr. | NR1I3 |
Gene ID | 9970 |
Full Name | nuclear receptor subfamily 1 group I member 3 |
Alias | CAR, CAR1, MB67 |
Introduction | This gene encodes a member of the nuclear receptor superfamily, and is a key regulator of xenobiotic and endobiotic metabolism. The protein binds to DNA as a monomer or a heterodimer with the retinoid X receptor and regulates the transcription of target genes involved in drug metabolism and bilirubin clearance, such as cytochrome P450 family members. Unlike most nuclear receptors, this transcriptional regulator is constitutively active in the absence of ligand but is regulated by both agonists and inverse agonists. Ligand binding results in translocation of this protein to the nucleus, where it activates or represses target gene transcription. These ligands include bilirubin, a variety of foreign compounds, steroid hormones, and prescription drugs. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq] |
Product Details | |
---|---|
Host | Rabbit |
Clonality | Polyclonal |
Clone No. | N/A |
Isotype | IgG |
Immunogen | Synthetic peptides corresponding to NR1I3(nuclear receptor subfamily 1, group I, member 3) The peptide sequence was selected from the middle region of NR1I3 (NP_001070939). Peptide sequence PVFRSLPIEDQISLLKGAAVEICHIVLNTTFCLQTQNFLCGPLRYTIEDG. The peptide sequence for this immunogen was taken from within the described region. |
Usage | |
---|---|
Application | WB, IHC |
Dilutions | Western Blot (0.2-1 µg/mL); Immunohistochemistry (1:10-1:500) |
Reactivity | Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit |
Storage & Handling | |
---|---|
Storage Buffer | PBS and 2% Sucrose. |
Preservative | 0.09% Sodium Azide |
Storage Temp. | Store at -20 °C. |
Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.