c-Jun Antibody - CD BioSciences

service-banner

c-Jun Antibody

c-Jun Antibody

SPA-01221

Size Price
25 µg Online Inquiry
100 µg Online Inquiry
More Options Online Inquiry
Target Information
Target Name c-Jun
Gene Abbr. JUN
Gene ID 3725
Full Name Jun proto-oncogene, AP-1 transcription factor subunit
Alias AP-1, AP1, c-Jun, cJUN, p39
Introduction c-Jun is a member of the Jun family containing c-Jun, JunB, and JunD, and is a component of the transcription factor activator protein-1 (AP-1). AP-1 is composed of dimers of Fos, Jun, and ATF family members and binds to and activates transcription at TRE/AP-1 elements. Extracellular signals including growth factors, chemokines, and stress activate AP-1-dependent transcription. The transcriptional activity of c-Jun is regulated by phosphorylation at Ser63 and Ser73 through SAPK/JNK. Knock-out studies in mice have shown that c-Jun is essential for embryogenesis and subsequent studies have demonstrated roles for c-Jun in various tissues and developmental processes including axon regeneration liver regeneration and T cell development. AP-1 regulated genes exert diverse biological functions including cell proliferation, differentiation, and apoptosis, as well as transformation, invasion and metastasis, depending on cell type and context. Other target genes regulate survival, as well as hypoxia and angiogenesis. Research studies have implicated c-Jun as a promising therapeutic target for cancer, vascular remodeling, acute inflammation, and rheumatoid arthritis.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Recombinant Protein corresponding to the following amino acid sequence: METTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLT.
Usage
Application IF
Dilutions Immunofluorescence (0.25-2 µg/mL)
MW(KDa) 43, 48
Reactivity Human, Mouse, Rat
Specificity Specificity of human Jun antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.