Online Inquiry
BAMBI/NMA Antibody
SPA-00891
| Size | Price |
| 0.1 mg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | BAMBI/NMA |
| Gene Abbr. | BAMBI |
| Gene ID | 25805 |
| Full Name | BMP and activin membrane bound inhibitor |
| Alias | NMA |
| Introduction | BAMBI/NMA is a type I transmembrane protein that shares sequence homology with the TGF-beta type I receptor family protein but has a short cytoplasmic region that lacks the kinase domain. It functions as a membrane-bound decoy receptor by competing with type I receptors to form a heterodimer with type II receptors. Mouse BAMBI/NMA share approximately 93% amino acid sequence homology with human BAMBI/NMA. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to amino acids: NKRLQDQRQQMLSRLHYSFHGHHSKKGQVAKLDLECMVPVSGHENCCLTCDKMRQADLSNDKILSLVHWGMYSGHGKLEFV. |
| Usage | |
|---|---|
| Application | IHC |
| Dilutions | Immunohistochemistry (1:20-1:50) |
| Reactivity | Human, Mouse, Rat |
| Specificity | Specificity of human BAMBI/NMA antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.