Online Inquiry
BAFFR/TNFRSF13C Antibody
SPA-10852
| Size | Price |
| 25 µg | Online Inquiry |
| 100 µg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | TNF receptor |
| Gene Abbr. | TNFRSF13C |
| Gene ID | 115650 |
| Full Name | TNF receptor superfamily member 13C |
| Alias | BAFF-R, BAFFR, BROMIX, CD268, CVID4 |
| Introduction | Members in the TNF superfamily regulate immune responses and induce apoptosis. A novel member in the TNF family was recently identified by several groups and designated BAFF, BLyS, TALL-1, THANK, and zTNF4. BAFF/BLyS was characterized as a B cell activator since it induced B cell proliferation and immunoglobulin secretion. Two receptors, TACI and BCMA, for BAFF were originally identified. A third receptor was identified recently and designated BAFF-R and BR3 for BLyS receptor 3. Unlike BCMA and TACI, which bind to BAFF and April, BAFF-R/BR3 is specific for BAFF and plays a predominant role in BAFF induced B cell development and survival. BAFF and its receptors are involved in B cell associated autoimmune diseases, and activate NF-kB and c-jun N-terminal kinase. |
| Product Details | |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Clone No. | N/A |
| Isotype | IgG |
| Immunogen | Recombinant Protein corresponding to amino acids: SWRRRQRRLRGASSAEAPDGDKDAPEPLDKVIILSPGISDATAPAWPPPGEDPGTTPPGHSVPVPATELGSTELVTTKTAGPEQQ. |
| Usage | |
|---|---|
| Application | WB, IHC |
| Dilutions | Western Blot (0.04-0.4 µg/mL); Immunohistochemistry (1:50-1:200) |
| Reactivity | Human |
| Specificity | Specificity of human, BAFF Receptor antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.2) and 40% Glycerol. |
| Preservative | 0.02% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.