Online Inquiry
ATF-4 Antibody
SPA-00635
| Size | Price |
| 0.05 mL | Online Inquiry |
| 0.025 mL | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | ATF-4 |
| Gene Abbr. | ATF4 |
| Gene ID | 468 |
| Full Name | activating transcription factor 4 |
| Alias | CREB-2, CREB2, TAXREB67, TXREB |
| Introduction | ATF-4, an activating transcription factor/cAMP-response element-binding protein family member, functions in the PERK and eIF2α ER stress responsive pathway. ER stress represses the translation of the majority of mRNAs, but selectively stimulates the translation of certain mRNAs including that of ATF-4. Induced expression of ATF-4 increases the expression of genes critical for the recovery from ER stress. |
| Product Details | |
|---|---|
| Host | Mouse |
| Clonality | Monoclonal |
| Clone No. | 2B3 |
| Isotype | IgG1 Kappa |
| Immunogen | ATF4 (NP_001666.2, 171 a.a. ~ 270 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SSTPDHSFSLELGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRGSPNRSLPSPGVLCGSARPKPYDPPGEKMVA. |
| Usage | |
|---|---|
| Application | WB, ELISA, IF |
| Dilutions | Western Blot (1:500); Immunofluorescence (1:10-1:2000); ELISA (1:100-1:2000) |
| MW(KDa) | 49 |
| Reactivity | Human, Mouse |
| Specificity | ATF4 - activating transcription factor 4 (tax-responsive enhancer element B67). |
| Storage & Handling | |
|---|---|
| Storage Buffer | In 1X PBS, pH 7.4. |
| Preservative | No Preservative |
| Storage Temp. | Aliquot and store at -20 °C or -80 °C. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.