Online Inquiry
Ataxin-1 Antibody
SPA-00609
| Size | Price |
| 25 µg | Online Inquiry |
| 100 µg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | Ataxin-1 |
| Gene Abbr. | ATXN1 |
| Gene ID | 6310 |
| Full Name | ataxin 1 |
| Alias | ATX1, D6S504E, SCA1 |
| Introduction | Spinocerebellar ataxia 1 (SCA1), an autosomal dominant neurodegenerative disorder, is characterized by slurred speech, loss of limb coordination, and gait abnormalities resulting from the degeneration of cerebellar Purkinje cells and of a subset of brainstem neurons. Individuals with SCA1 have a highly polymorphic CAG repeat expansion encoding a polyglutamine tract in ataxin-1. Akt phosphorylates ataxin-1 at Ser776, which regulates an association with 14-3-3. This interaction increases ataxin-1 stabilization and accumulation resulting in enhanced neurodegeneration. In addition, HSP70 controls the effect that phosphorylation has on ataxin-1 stability. |
| Product Details | |
|---|---|
| Host | Mouse |
| Clonality | Monoclonal |
| Clone No. | S76-8 |
| Isotype | IgG2B |
| Immunogen | Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). |
| Usage | |
|---|---|
| Application | WB, IF, IHC, IP |
| Dilutions | Western Blot (1:1000) |
| MW(KDa) | 105 |
| Reactivity | Human, Mouse, Rat |
| Specificity | Detects approx 85kDa. |
| Storage & Handling | |
|---|---|
| Storage Buffer | PBS (pH 7.4) and 50% Glycerol. |
| Preservative | 0.1% Sodium Azide |
| Storage Temp. | Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.