Online Inquiry
ARA54 Antibody
SPA-00550
| Size | Price |
| 25 µg | Online Inquiry |
| 100 µg | Online Inquiry |
| More Options | Online Inquiry |
| Target Information | |
|---|---|
| Target Name | ARA54 |
| Gene Abbr. | RNF14 |
| Gene ID | 9604 |
| Full Name | ring finger protein 14 |
| Alias | ARA54, HFB30, HRIHFB2038, TRIAD2 |
| Introduction | ARA54 (androgen receptor associated protein 54; also RING finger protein 14) is a 50‑55 kDa member of the zinc finger superfamily of proteins. It is ubiquitously expressed, and has two functions; one is to serve as a homodimeric co‑activator for androgen receptor‑induced transcription, and a second as an E3 ubiquitin-protein ligase. Human ARA54 is 474 amino acids (aa) in length and contains an RDW domain that interacts with E2 ubiquitin ligase (aa 11‑137), two zinc finger domains that qualify as RING-type (aa 220‑266) and IBR-type (aa 289‑350), and an androgen-interaction region (aa 361‑474) that contains a coiled‑coil domain. There is one alternate start site at Met127. Over aa 127‑261, human ARA54 is 87% aa identical to mouse ARA54. |
| Product Details | |
|---|---|
| Host | Mouse |
| Clonality | Monoclonal |
| Clone No. | 4G9 |
| Isotype | IgG2A Kappa |
| Immunogen | RNF14 (NP_004281, 217 a.a. ~ 316 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LFLCSICFCEKLGSECMYFLECRHVYCKACLKDYFEIQIRDGQVQCLNCPEPKCPSVATPGQVKELVEAELFARYDRLLLQSSLDLMADVVYCPRPCCQL. |
| Usage | |
|---|---|
| Application | WB, ELISA, IF |
| Dilutions | Western Blot (1:500) |
| Reactivity | Human |
| Specificity | RNF14 - ring finger protein 14. |
| Storage & Handling | |
|---|---|
| Storage Buffer | In 1X PBS, pH 7.4. |
| Preservative | No Preservative |
| Storage Temp. | Aliquot and store at -20 °C or -80 °C. |
| Handling | Avoid freeze-thaw cycles. |
For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.