ADAMTS3 Antibody - CD BioSciences

service-banner

ADAMTS3 Antibody

ADAMTS3 Antibody

SPA-00221

Size Price
25 µg Online Inquiry
100 µg Online Inquiry
More Options Online Inquiry
Target Information
Target Name ADAMTS3
Gene Abbr. ADAMTS3
Gene ID 9508
Full Name ADAM metallopeptidase with thrombospondin type 1 motif 3
Alias ADAMTS-4, HKLLS3
Introduction ADAMTS3 (A disintegrin and metalloprotease with thrombospondin motifs 3; also PC II-NP) is a 140-150 kDa member of the ADAMTS family of Zn metalloproteases. It is expressed by osteoblasts, chrondrocytes, myoepithelium and fibroblasts, and participates in collagen maturation. Together with ADAMTS2 and TS14, ADAMTS3 is known to process the N-terminus of procollagen. In particular, it cleaves the N-terminal globular region of collagen I and II, leading to fibril formation. Mature human proADAMTS3 is a secreted, 1185 amino acid (aa) glycoprotein. It is highly modular and contains a proregion (aa 38-201), a peptidase M12B domain (aa 256-460), a disintegrin region (aa 470-550), four TSP type I sequences (aa 551-1015), and a PLAC domain (aa 1015-1054). There are two potential splice variants. One shows a 38 aa substitution for aa 169-1205, while another shows an alternative start site at Met171. Over aa 19-712, human ADAMTS3 shares 91% aa identity with mouse ADAMTS3.
Product Details
Host Mouse
Clonality Monoclonal
Clone No. 1H8
Isotype IgG1 Kappa
Immunogen ADAMTS3 (NP_055058.1, 1048 a.a. ~ 1128 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ESCSKRSSTLPPPYLLEAAETHDDVISNPSDLPRSLVMPTSLVPYHSETPAKKMSLSSISSVGGPNAYAAFRPNSKPDGAN.
Usage
Application WB, ELISA
Reactivity Human
Storage & Handling
Storage Buffer In 1X PBS, pH 7.4.
Preservative No Preservative
Storage Temp. Aliquot and store at -20 °C or -80 °C.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.