ABHD14A Antibody - CD BioSciences

service-banner

ABHD14A Antibody

ABHD14A Antibody

SPA-00120

Size Price
0.1 mL Online Inquiry
More Options Online Inquiry
Target Information
Target Name ABHD14A
Gene Abbr. ABHD14A
Gene ID 25864
Full Name abhydrolase domain containing 14A
Alias DORZ1
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Recombinant Protein corresponding to the following amino acid sequence: PEQTSCLWGDPNVTVLAGLTPGNSPIFYREVLPLNQAHRVEVVLLHGKAFNSHTWEQL.
Usage
Application WB, IF
Dilutions Western Blot (0.04-0.4 µg/mL); Immunofluorescence (0.25-2 µg/mL)
Reactivity Human
Specificity Specificity of human ABHD14A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.