service-banner

PRAS40 Antibody

PRAS40 Antibody

SPA-00377

Size Price
0.1 mg Online Inquiry
0.025 mg Online Inquiry
More Options Online Inquiry
Target Information
Target Name AKT1S1
Gene Abbr. AKT1S1
Gene ID 84335
Full Name AKT1 substrate 1
Alias Lobe, PRAS40
Introduction Many growth factors and hormones induce the phosphoinositide 3-kinase signaling pathway, which results in the activation of downstream effector proteins such as the serine/threonine kinase Akt. One known Akt substrate is a 40 kDa, proline-rich protein (PRAS40) that binds to 14-3-3 proteins. PRAS40 also binds mTOR to transduce Akt signals to the mTOR complex. Inhibition of mTOR signaling stimulates PRAS40 binding to mTOR, which in turn inhibits mTOR activity. PRAS40 interacts with raptor in mTOR complex 1 (mTORC1) in insulin-deprived cells and inhibits the activation of the mTORC1 pathway mediated by the cell cycle protein Rheb. Phosphorylation of PRAS40 by Akt at Thr246 relieves PRAS40 inhibition of mTORC1. mTORC1 in turn phosphorylates PRAS40 at Ser183.
Product Details
Host Rabbit
Clonality Polyclonal
Clone No. N/A
Isotype IgG
Immunogen Recombinant Protein corresponding to the following amino acid sequence: KSLPVSVPVWGFKEKRTEARSSDEENGPPSSPDLDRIAASMRALVLREAEDTQVFGDLPRPRLNTSDFQKLKRK.
Usage
Application IHC
Dilutions Immunohistochemistry (1:50-1:200)
Reactivity Human, Mouse, Rat
Specificity Specificity of human PRAS40 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Storage & Handling
Storage Buffer PBS (pH 7.2) and 40% Glycerol.
Preservative 0.02% Sodium Azide
Storage Temp. Store at 4 °C for a short term. Aliquot and store at -20 °C for long-term storage.
Handling Avoid freeze-thaw cycles.

For research use only. Not intended for any clinical use. No products from CD BioSciences may be resold, modified for resale or used to manufacture commercial products without prior written approval from CD BioSciences.